PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0471s00140.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family YABBY
Protein Properties Length: 165aa    MW: 18975.9 Da    PI: 9.3386
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0471s00140.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY105.11.4e-3273130101159
             YABBY 101 lsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaakn 159
                         e+ d+e pr+pp irPPekrqrvPsaynrfikeeiqrikasnPdishreafs+aakn
  Vang0471s00140.2  73 SFESVDHEQPRIPP-IRPPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKN 130
                       246678999**999.9******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046907.2E-3161130IPR006780YABBY protein
SuperFamilySSF470951.15E-686129IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MPSEIESDDI CLLFHPKMGF GRSVFHAAVC SPLLRLDVDT VPICYQLTWE HHFNLFLLKK  60
LSKELGSSSK CKSFESVDHE QPRIPPIRPP EKRQRVPSAY NRFIKEEIQR IKASNPDISH  120
REAFSTAAKN RSMSVSSKRT TSTVLFIFEM LQFDPFFRNI VLHP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150402e-98AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.13e-21YABBY family protein